Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Type-1 angiotensin II receptor B |
---|
Ligand | BDBM50039346 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_36643 (CHEMBL652353) |
---|
Ki | 11±n/a nM |
---|
Citation | Nicolaï, E; Curé, G; Goyard, J; Kirchner, M; Teulon, JM; Versigny, A; Cazes, M; Caussade, F; Virone-Oddos, A; Cloarec, A Synthesis and SAR studies of novel triazolopyrimidine derivatives as potent, orally active angiotensin II receptor antagonists. J Med Chem37:2371-86 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Type-1 angiotensin II receptor B |
---|
Name: | Type-1 angiotensin II receptor B |
Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 40929.44 |
Organism: | RAT |
Description: | Angiotensin II AT1B 0 RAT::P29089 |
Residue: | 359 |
Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
BDBM50039346 |
---|
n/a |
---|
Name | BDBM50039346 |
Synonyms: | 5-Methyl-7-propyl-8-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-[1,2,4]triazolo[1,5-c]pyrimidine-2-sulfonic acid amide | CHEMBL79879 |
Type | Small organic molecule |
Emp. Form. | C23H23N9O2S |
Mol. Mass. | 489.553 |
SMILES | CCCc1nc(C)n2nc(nc2c1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1)S(N)(=O)=O |
Structure |
|