Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Ligand | BDBM50496771 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1332679 (CHEMBL3224261) |
---|
IC50 | 343400±n/a nM |
---|
Citation | Bitok, JK; Meyers, CF Synthesis and evaluation of stable substrate analogs as potential modulators of cyclodiphosphate synthase IspF. Medchemcomm4:130-134 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
Synonyms: | 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase (IspF) | ISPF_ECOLI | MECDP-synthase | MECPS | ispF | mecS | ygbB |
Type: | Homotrimer |
Mol. Mass.: | 16897.34 |
Organism: | Escherichia coli (strain K12) |
Description: | P62617 |
Residue: | 159 |
Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
|
|
|
BDBM50496771 |
---|
n/a |
---|
Name | BDBM50496771 |
Synonyms: | CHEMBL3220831 |
Type | Small organic molecule |
Emp. Form. | C10H17N3O10P2 |
Mol. Mass. | 401.2036 |
SMILES | Nc1ccn([C@@H]2O[C@H](COP(O)(=O)CP(O)(O)=O)[C@@H](O)[C@H]2O)c(=O)n1 |r| |
Structure |
|