Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM73215 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1822298 (CHEMBL4322062) |
---|
IC50 | 294±n/a nM |
---|
Citation | Aretz, CD; Vadukoot, AK; Hopkins, CR Discovery of Small Molecule Renal Outer Medullary Potassium (ROMK) Channel Inhibitors: A Brief History of Medicinal Chemistry Approaches To Develop Novel Diuretic Therapeutics. J Med Chem62:8682-8694 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
Type: | Enzyme |
Mol. Mass.: | 44976.27 |
Organism: | Rattus norvegicus (Rat) |
Description: | P35560 |
Residue: | 391 |
Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
BDBM73215 |
---|
n/a |
---|
Name | BDBM73215 |
Synonyms: | 7,13-bis(4-nitrobenzyl)-1,4,10-trioxa-7,13-diazacyclopentadecane;2,2,2-trifluoroacetic acid | 7,13-bis[(4-nitrophenyl)methyl]-1,4,10-trioxa-7,13-diazacyclopentadecane;2,2,2-trifluoroacetic acid | 7,13-bis[(4-nitrophenyl)methyl]-1,4,10-trioxa-7,13-diazacyclopentadecane;2,2,2-tris(fluoranyl)ethanoic acid | CHEMBL1401670 | VU0277590-7 | cid_44176372 |
Type | Small organic molecule |
Emp. Form. | C24H32N4O7 |
Mol. Mass. | 488.5335 |
SMILES | [O-][N+](=O)c1ccc(CN2CCOCCOCCN(Cc3ccc(cc3)[N+]([O-])=O)CCOCC2)cc1 |
Structure |
|