| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50515059 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1859869 (CHEMBL4360725) |
|---|
| Ki | 24±n/a nM |
|---|
| Citation |  Dvorácskó, S; Keresztes, A; Mollica, A; Stefanucci, A; Macedonio, G; Pieretti, S; Zádor, F; Walter, FR; Deli, MA; Kékesi, G; Bánki, L; Tuboly, G; Horváth, G; Tömböly, C Preparation of bivalent agonists for targeting the mu opioid and cannabinoid receptors. Eur J Med Chem178:571-588 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50515059 |
|---|
| n/a |
|---|
| Name | BDBM50515059 |
|---|
| Synonyms: | CHEMBL4528931 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N2O6 |
|---|
| Mol. Mass. | 388.4144 |
|---|
| SMILES | [H][C@@]12Oc3c4c(C[C@@]5([H])N(C)CC[C@@]14[C@@]5(O)CC\C2=N\OCC(O)=O)ccc3OC |r,THB:10:9:14:4.5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
