| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50078091 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159438 (CHEMBL763234) |
|---|
| pH | 6.2±n/a |
|---|
| IC50 | 14±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Vara Prasad, JV; Boyer, FE; Domagala, JM; Ellsworth, EL; Gajda, C; Hagen, SE; Markoski, LJ; Tait, BD; Lunney, EA; Tummino, PJ; Ferguson, D; Holler, T; Hupe, D; Nouhan, C; Gracheck, SJ; VanderRoest, S; Saunders, J; Iyer, K; Sinz, M; Brodfuehrer, J Nonpeptidic HIV protease inhibitors: 6-alkyl-5,6-dihydropyran-2-ones possessing achiral 3-(4-amino/carboxamide-2-t-butyl,5-methylphenyl thio) moiety: antiviral activities and pharmacokinetic properties. Bioorg Med Chem Lett9:1481-6 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50078091 |
|---|
| n/a |
|---|
| Name | BDBM50078091 |
|---|
| Synonyms: | CHEMBL284341 | N-[5-tert-Butyl-4-(4-hydroxy-6-isopropyl-2-oxo-6-phenethyl-5,6-dihydro-2H-pyran-3-ylsulfanyl)-2-methyl-phenyl]-4-cyano-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H38N2O4S |
|---|
| Mol. Mass. | 582.752 |
|---|
| SMILES | CC(C)C1(CCc2ccccc2)CC(=O)C(Sc2cc(C)c(NC(=O)c3ccc(cc3)C#N)cc2C(C)(C)C)C(=O)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
