Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50018094 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201585 (CHEMBL809862) |
---|
Ki | 34±n/a nM |
---|
Citation | Efange, SM; Khare, AB; Mach, RH; Parsons, SM Hydroxylated decahydroquinolines as ligands for the vesicular acetylcholine transporter: synthesis and biological evaluation. J Med Chem42:2862-9 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50018094 |
---|
n/a |
---|
Name | BDBM50018094 |
Synonyms: | (1R,2R)-2-(4-Phenyl-piperidin-1-yl)-cyclohexanol | 2-(4-Phenyl-piperidin-1-yl)-cyclohexanol | 2-(4-Phenyl-piperidin-1-yl)-cyclohexanol(Vesamicol) | CHEMBL20730 | Vesamicol | trans-2-(4-phenylpiperidin-1-yl)cyclohexanol |
Type | Small organic molecule |
Emp. Form. | C17H25NO |
Mol. Mass. | 259.3865 |
SMILES | O[C@@H]1CCCC[C@H]1N1CCC(CC1)c1ccccc1 |r| |
Structure |
|