Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
---|
Ligand | BDBM50070209 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1897046 (CHEMBL4399081) |
---|
IC50 | 53000±n/a nM |
---|
Citation | Leroux, F; Bosc, D; Beghyn, T; Hermant, P; Warenghem, S; Landry, V; Pottiez, V; Guillaume, V; Charton, J; Herledan, A; Urata, S; Liang, W; Sheng, L; Tang, WJ; Deprez, B; Deprez-Poulain, R Identification of ebselen as a potent inhibitor of insulin degrading enzyme by a drug repurposing screening. Eur J Med Chem179:557-566 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
---|
Name: | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
Synonyms: | DDAH | DDAH1 | DDAH1_HUMAN | Dimethylarginine dimethylaminohydrolase (DDAH-1) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) E78A | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L271G | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L30A | Dimethylarginine dimethylaminohydrolase 1 (DDAH1) | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
Type: | Protein |
Mol. Mass.: | 31116.90 |
Organism: | Homo sapiens (Human) |
Description: | O94760 |
Residue: | 285 |
Sequence: | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
|
|
|
BDBM50070209 |
---|
n/a |
---|
Name | BDBM50070209 |
Synonyms: | Aciphex | CHEBI:8768 | LY-307640 | Rabeprazole |
Type | Small organic molecule |
Emp. Form. | C18H21N3O3S |
Mol. Mass. | 359.443 |
SMILES | COCCCOc1ccnc(C[S+]([O-])c2nc3ccccc3[nH]2)c1C |
Structure |
|