Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50085536 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1930131 (CHEMBL4433382) |
---|
IC50 | 7100000±n/a nM |
---|
Citation | Golonko, A; Pienkowski, T; Swislocka, R; Lazny, R; Roszko, M; Lewandowski, W Another look at phenolic compounds in cancer therapy the effect of polyphenols on ubiquitin-proteasome system. Eur J Med Chem167:291-311 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50085536 |
---|
n/a |
---|
Name | BDBM50085536 |
Synonyms: | 3,4,5-Trihydroxybenzoate, X | 3,4,5-trihydroxybenzoic acid | CHEMBL288114 | Gallic Acid, F | gallic acid |
Type | Small organic molecule |
Emp. Form. | C7H6O5 |
Mol. Mass. | 170.1195 |
SMILES | OC(=O)c1cc(O)c(O)c(O)c1 |
Structure |
|