| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50091872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159297 |
|---|
| IC50 | 10000±n/a nM |
|---|
| Citation |  Kraus, JL; Bouygues, M; Courcambeck, J; Chermann, JC Use of proline bioisosteres in potential HIV protease inhibitors: phenylalanine-2-thiophenoxy-3-pyrrolidinone: synthesis and anti-HIV evaluation. Bioorg Med Chem Lett10:2023-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50091872 |
|---|
| n/a |
|---|
| Name | BDBM50091872 |
|---|
| Synonyms: | CHEMBL62621 | [(S)-1-(4-Methoxy-benzyl)-2-oxo-2-((S)-3-oxo-2-phenylsulfanyl-pyrrolidin-1-yl)-ethyl]-carbamic acid tert-butyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N2O5S |
|---|
| Mol. Mass. | 470.581 |
|---|
| SMILES | COc1ccc(C[C@H](NC(=O)OC(C)(C)C)C(=O)N2CCC(=O)[C@@H]2Sc2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
