Reaction Details |
| Report a problem with these data |
Target | Interleukin-1 receptor antagonist protein |
---|
Ligand | BDBM50553094 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2045076 (CHEMBL4699775) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Barlow, N; Vanga, SR; Sävmarker, J; Sandström, A; Burns, P; Hallberg, A; Åqvist, J; Gutiérrez-de-Terán, H; Hallberg, M; Larhed, M; Chai, SY; Thompson, PE Macrocyclic peptidomimetics as inhibitors of insulin-regulated aminopeptidase (IRAP). RSC Med Chem11:234-244 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-1 receptor antagonist protein |
---|
Name: | Interleukin-1 receptor antagonist protein |
Synonyms: | ICIL-1RA | IL-1RN | IL-1ra | IL1 inhibitor | IL1F3 | IL1RA | IL1RA_HUMAN | IL1RN | INN=Anakinra | IRAP | Interleukin-1 receptor antagonist protein |
Type: | PROTEIN |
Mol. Mass.: | 20053.78 |
Organism: | Homo sapiens |
Description: | ChEMBL_118941 |
Residue: | 177 |
Sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
|
|
|
BDBM50553094 |
---|
n/a |
---|
Name | BDBM50553094 |
Synonyms: | CHEMBL4761376 |
Type | Small organic molecule |
Emp. Form. | C27H33N5O7 |
Mol. Mass. | 539.5802 |
SMILES | N[C@H]1CNC(=O)CC[C@H](NC(=O)C[C@H](Cc2ccc(O)cc2)NC1=O)C(=O)NCc1ccccc1CC(O)=O |r| |
Structure |
|