Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50562046 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2076987 (CHEMBL4732778) |
---|
Ki | 1450±n/a nM |
---|
Citation | Deuther-Conrad, W; Diez-Iriepa, D; Iriepa, I; López-Muñoz, F; Martínez-Grau, MA; Gütschow, M; Marco-Contelles, J Studies on the affinity of 6-[( RSC Med Chem12:1000-1004 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50562046 |
---|
n/a |
---|
Name | BDBM50562046 |
Synonyms: | CHEMBL4778990 |
Type | Small organic molecule |
Emp. Form. | C18H23NO3 |
Mol. Mass. | 301.3801 |
SMILES | O=c1ccoc2ccc(OCCCCCN3CCCC3)cc12 |
Structure |
|