Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50127149 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54971 (CHEMBL666700) |
---|
IC50 | 14000±n/a nM |
---|
Citation | Rosowsky, A; Forsch, RA; Queener, SF Further studies on 2,4-diamino-5-(2',5'-disubstituted benzyl)pyrimidines as potent and selective inhibitors of dihydrofolate reductases from three major opportunistic pathogens of AIDS. J Med Chem46:1726-36 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50127149 |
---|
n/a |
---|
Name | BDBM50127149 |
Synonyms: | 3-{3-[3-(2,4-Diamino-pyrimidin-5-ylmethyl)-4-methoxy-phenyl]-prop-2-ynyloxy}-benzoic acid | CHEMBL35080 |
Type | Small organic molecule |
Emp. Form. | C22H20N4O4 |
Mol. Mass. | 404.4186 |
SMILES | COc1ccc(cc1Cc1cnc(N)nc1N)C#CCOc1cccc(c1)C(O)=O |
Structure |
|