Reaction Details |
| Report a problem with these data |
Target | Interleukin-2 |
---|
Ligand | BDBM50571045 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2113698 (CHEMBL4822548) |
---|
IC50 | >30000±n/a nM |
---|
Citation | Smadja, J; Quéméner, A; Maillasson, M; Sicard, B; Leray, A; Arzel, L; Lebreton, J; Mortier, E; Dubreuil, D; Mathé-Allainmat, M Rational modification, synthesis and biological evaluation of N-substituted phthalazinone derivatives designed to target interleukine-15 protein. Bioorg Med Chem39:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-2 |
---|
Name: | Interleukin-2 |
Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
Type: | Enzyme |
Mol. Mass.: | 17630.05 |
Organism: | Homo sapiens (Human) |
Description: | P60568 |
Residue: | 153 |
Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
BDBM50571045 |
---|
n/a |
---|
Name | BDBM50571045 |
Synonyms: | CHEMBL4848978 |
Type | Small organic molecule |
Emp. Form. | C23H20Cl2N6O3S |
Mol. Mass. | 531.414 |
SMILES | Cn1c(Cc2nn(CCC=O)c(=O)c3ccccc23)nnc1SCC(=O)Nc1ccc(Cl)cc1Cl |
Structure |
|