| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D(3) dopamine receptor |
|---|
| Ligand | BDBM50131346 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303376 (CHEMBL839694) |
|---|
| Ki | 433±n/a nM |
|---|
| Citation |  Andrés, JI; Alcázar, J; Alonso, JM; Alvarez, RM; Bakker, MH; Biesmans, I; Cid, JM; De Lucas, AI; Fernández, J; Font, LM; Hens, KA; Iturrino, L; Lenaerts, I; Martínez, S; Megens, AA; Pastor, J; Vermote, PC; Steckler, T Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking activity. J Med Chem48:2054-71 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D(3) dopamine receptor |
|---|
| Name: | D(3) dopamine receptor |
|---|
| Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 44243.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 400 |
|---|
| Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
|---|
| BDBM50131346 |
|---|
| n/a |
|---|
| Name | BDBM50131346 |
|---|
| Synonyms: | (3R,3aS)-7,8-Dimethoxy-3-[4-((E)-2-methyl-3-phenyl-allyl)-piperazin-1-ylmethyl]-3a,4-dihydro-3H-chromeno[4,3-c]isoxazole | (3R,3aS)-7,8-Dimethoxy-3-[4-(2-methyl-3-phenyl-allyl)-piperazin-1-ylmethyl]-3a,4-dihydro-3H-chromeno[4,3-c]isoxazole | CHEMBL91157 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H33N3O4 |
|---|
| Mol. Mass. | 463.5686 |
|---|
| SMILES | COc1cc2OC[C@H]3[C@H](CN4CCN(C\C(C)=C\c5ccccc5)CC4)ON=C3c2cc1OC |c:29| |
|---|
| Structure | 
|
|---|
Search and Browse
