Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Galectin-1 |
---|
Ligand | BDBM50591131 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2199440 (CHEMBL5111956) |
---|
Kd | 5180±n/a nM |
---|
Citation | Zetterberg, FR; MacKinnon, A; Brimert, T; Gravelle, L; Johnsson, RE; Kahl-Knutson, B; Leffler, H; Nilsson, UJ; Pedersen, A; Peterson, K; Roper, JA; Schambye, H; Slack, RJ; Tantawi, S Discovery and Optimization of the First Highly Effective and Orally Available Galectin-3 Inhibitors for Treatment of Fibrotic Disease. J Med Chem65:12626-12638 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-1 |
---|
Name: | Galectin-1 |
Synonyms: | 14 kDa lectin | Beta-galactoside-binding lectin L-14-I | Gal-1 | Galaptin | Galectin-1 | LEG1_RAT | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Lgals1 | RL 14.5 | S-Lac lectin 1 |
Type: | PROTEIN |
Mol. Mass.: | 14853.16 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_118933 |
Residue: | 135 |
Sequence: | MACGLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINY
MAADGDFKIKCVAFE
|
|
|
BDBM50591131 |
---|
n/a |
---|
Name | BDBM50591131 |
Synonyms: | CHEMBL5193805 |
Type | Small organic molecule |
Emp. Form. | C21H16ClF3N4O4S |
Mol. Mass. | 512.889 |
SMILES | OC[C@H]1O[C@H](Sc2ccc(C#N)c(Cl)c2)[C@H](O)[C@H]([C@H]1O)n1cc(nn1)-c1cc(F)c(F)c(F)c1 |r| |
Structure |
|