Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Tryptase delta |
---|
Ligand | BDBM408717 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2200339 (CHEMBL5112855) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Davie, RL; Edwards, HJ; Evans, DM; Hodgson, ST; Stocks, MJ; Smith, AJ; Rushbrooke, LJ; Pethen, SJ; Roe, MB; Clark, DE; McEwan, PA; Hampton, SL Sebetralstat (KVD900): A Potent and Selective Small Molecule Plasma Kallikrein Inhibitor Featuring a Novel P1 Group as a Potential Oral On-Demand Treatment for Hereditary Angioedema. J Med Chem65:13629-13644 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase delta |
---|
Name: | Tryptase delta |
Synonyms: | Delta-tryptase | HmMCP-3-like tryptase III | Mast cell mMCP-7-like | TPSD1 | TRYD_HUMAN | Tryptase delta | Tryptase-3 |
Type: | PROTEIN |
Mol. Mass.: | 26578.73 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_104777 |
Residue: | 242 |
Sequence: | MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGP
YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF
YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPY
PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVN
GT
|
|
|
BDBM408717 |
---|
n/a |
---|
Name | BDBM408717 |
Synonyms: | N-[(3-fluoro-4-methoxypyridin-2-yl)methyl]-3-(methoxymethyl)-1-({4-[(2-oxopyridin- 1-yl)methyl]phenyl}methyl)pyrazole-4-carboxamide | US10364238, Example 41 | US10730874, Example 00397 | US11001578, Example 41 | US11084809, Example 41 | US11198691, Example 41 | US11352356, Table II.3 | US11584735, Example 41 of WO2016/083820 |
Type | Small organic molecule |
Emp. Form. | C26H26FN5O4 |
Mol. Mass. | 491.5141 |
SMILES | COCc1nn(Cc2ccc(Cn3ccccc3=O)cc2)cc1C(=O)NCc1nccc(OC)c1F |
Structure |
|