| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50181876 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_332726 (CHEMBL858941) |
|---|
| IC50 | 6300±n/a nM |
|---|
| Citation |  Wendt, MD; Shen, W; Kunzer, A; McClellan, WJ; Bruncko, M; Oost, TK; Ding, H; Joseph, MK; Zhang, H; Nimmer, PM; Ng, SC; Shoemaker, AR; Petros, AM; Oleksijew, A; Marsh, K; Bauch, J; Oltersdorf, T; Belli, BA; Martineau, D; Fesik, SW; Rosenberg, SH; Elmore, SW Discovery and structure-activity relationship of antagonists of B-cell lymphoma 2 family proteins with chemopotentiation activity in vitro and in vivo. J Med Chem49:1165-81 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50181876 |
|---|
| n/a |
|---|
| Name | BDBM50181876 |
|---|
| Synonyms: | CHEMBL371861 | N-(4'-fluoro-biphenyl-4-carbonyl)-3-nitro-4-(2-phenylsulfanyl-ethylamino)-benzenesulfonamide | N-[(4'-FLUORO-1,1'-BIPHENYL-4-YL)CARBONYL]-3-NITRO-4-{[2-(PHENYLSULFANYL)ETHYL]AMINO}BENZENESULFONAMIDE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H22FN3O5S2 |
|---|
| Mol. Mass. | 551.609 |
|---|
| SMILES | [O-][N+](=O)c1cc(ccc1NCCSc1ccccc1)S(=O)(=O)NC(=O)c1ccc(cc1)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
