| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM17349 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_399772 (CHEMBL910307) |
|---|
| Ki | 1000±n/a nM |
|---|
| Citation |  Skalova, T; Dohnalek, J; Duskova, J; Petrokova, H; Hradílek, M; Soucek, M; Konvalinka, J; Hasek, J HIV-1 protease mutations and inhibitor modifications monitored on a series of complexes. Structural basis for the effect of the A71V mutation on the active site. J Med Chem49:5777-84 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM17349 |
|---|
| n/a |
|---|
| Name | BDBM17349 |
|---|
| Synonyms: | CHEMBL386758 | tert-butyl N-[(2S,3S)-4-{[(1S)-1-{[(1S)-3-carbamoyl-1-{[(1S)-1-carbamoyl-2-phenylethyl]carbamoyl}propyl]carbamoyl}-2-phenylethyl]amino}-3-hydroxy-1-phenylbutan-2-yl]carbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H50N6O7 |
|---|
| Mol. Mass. | 702.8396 |
|---|
| SMILES | CC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@@H](O)CN[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
