Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50228129 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_452413 (CHEMBL902649) |
---|
Kd | 231000±n/a nM |
---|
Citation | Stebbins, JL; Zhang, Z; Chen, J; Wu, B; Emdadi, A; Williams, ME; Cashman, J; Pellecchia, M Nuclear magnetic resonance fragment-based identification of novel FKBP12 inhibitors. J Med Chem50:6607-17 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50228129 |
---|
n/a |
---|
Name | BDBM50228129 |
Synonyms: | 2-(4-chloro-3,5-dimethylphenoxy)-1-morpholinoethanone | CHEMBL235468 |
Type | Small organic molecule |
Emp. Form. | C14H18ClNO3 |
Mol. Mass. | 283.751 |
SMILES | Cc1cc(OCC(=O)N2CCOCC2)cc(C)c1Cl |
Structure |
|