| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoglyceride lipase |
|---|
| Ligand | BDBM50271030 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_552793 (CHEMBL954830) |
|---|
| IC50 | 100000±n/a nM |
|---|
| Citation |  Mor, M; Lodola, A; Rivara, S; Vacondio, F; Duranti, A; Tontini, A; Sanchini, S; Piersanti, G; Clapper, JR; King, AR; Tarzia, G; Piomelli, D Synthesis and quantitative structure-activity relationship of fatty acid amide hydrolase inhibitors: modulation at the N-portion of biphenyl-3-yl alkylcarbamates. J Med Chem51:3487-98 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoglyceride lipase |
|---|
| Name: | Monoglyceride lipase |
|---|
| Synonyms: | MAGL | MGLL_RAT | Mgl2 | Mgll | Monoacylglycerol lipase | Monoglyceride lipase | Monoglyceride lipase (MGL) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33505.38 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q8R431 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLG
HSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRID
SSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGAR
CLP
|
|
|
|---|
| BDBM50271030 |
|---|
| n/a |
|---|
| Name | BDBM50271030 |
|---|
| Synonyms: | 3'-carbamoylbiphenyl-3-yl naphthalen-2-ylmethylcarbamate | CHEMBL483697 | Naphthalen-2-ylmethylcarbamic Acid 3'-Carbamoylbiphenyl-3-yl Ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H20N2O3 |
|---|
| Mol. Mass. | 396.4379 |
|---|
| SMILES | NC(=O)c1cccc(c1)-c1cccc(OC(=O)NCc2ccc3ccccc3c2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
