Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM50254299 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_560535 (CHEMBL1021385) |
---|
Ki | 450±n/a nM |
---|
Citation | Gillespie, RJ; Bamford, SJ; Botting, R; Comer, M; Denny, S; Gaur, S; Griffin, M; Jordan, AM; Knight, AR; Lerpiniere, J; Leonardi, S; Lightowler, S; McAteer, S; Merrett, A; Misra, A; Padfield, A; Reece, M; Saadi, M; Selwood, DL; Stratton, GC; Surry, D; Todd, R; Tong, X; Ruston, V; Upton, R; Weiss, SM Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem52:33-47 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM50254299 |
---|
n/a |
---|
Name | BDBM50254299 |
Synonyms: | 3-(2,5-Difluorobenzyl)-7-(2-furyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine-5-amine | CHEMBL467245 |
Type | Small organic molecule |
Emp. Form. | C15H10F2N6O |
Mol. Mass. | 328.2763 |
SMILES | Nc1nc(-c2ccco2)c2nnn(Cc3cc(F)ccc3F)c2n1 |
Structure |
|