Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50282582 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79794 (CHEMBL696054) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Randad, RS; Pan, W; Gulnik, SV; Burt, S; Erickson, JW De novo design of nonpeptidic HIV-1 protease inhibitors: Incorporation of structural water. Bioorg Med Chem Lett4:1247-1252 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50282582 |
---|
n/a |
---|
Name | BDBM50282582 |
Synonyms: | (4S,6S)-4,6-Dibenzyl-5-hydroxy-tetrahydro-pyrimidin-2-one | CHEMBL25704 |
Type | Small organic molecule |
Emp. Form. | C18H20N2O2 |
Mol. Mass. | 296.3636 |
SMILES | OC1[C@H](Cc2ccccc2)NC(=O)N[C@H]1Cc1ccccc1 |
Structure |
|