Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50287019 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159443 |
---|
IC50 | 990±n/a nM |
---|
Citation | Prasad, JV; Pavlovsky, A; Para, KS; Ellsworth, EL; Tummino, PJ; Nouhan, C; Ferguson, D Nonpeptidic HIV protease inhibitors: 3-(S-benzyl substituted)-4-hydroxy-6-(phenyl substituted)-2H-pyran-2-one with an inverse mode of binding Bioorg Med Chem Lett6:1133-1138 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50287019 |
---|
n/a |
---|
Name | BDBM50287019 |
Synonyms: | 3-Benzylsulfanyl-4-hydroxy-6-(3-methoxy-phenyl)-pyran-2-one | CHEMBL14828 |
Type | Small organic molecule |
Emp. Form. | C19H16O4S |
Mol. Mass. | 340.393 |
SMILES | COc1cccc(c1)-c1cc(O)c(SCc2ccccc2)c(=O)o1 |
Structure |
|