Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50315510 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_626787 (CHEMBL1107234) |
---|
IC50 | 3.8±n/a nM |
---|
Citation | Zhou, N; Polozov, AM; O'Connell, M; Burgeson, J; Yu, P; Zeller, W; Zhang, J; Onua, E; Ramirez, J; Palsdottir, GA; Halldorsdottir, GV; Andresson, T; Kiselyov, AS; Gurney, M; Singh, J 1,7-Disubstituted oxyindoles are potent and selective EP(3) receptor antagonists. Bioorg Med Chem Lett20:2658-64 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
Type: | Enzyme |
Mol. Mass.: | 43335.03 |
Organism: | Homo sapiens (Human) |
Description: | P43115 |
Residue: | 390 |
Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
BDBM50315510 |
---|
n/a |
---|
Name | BDBM50315510 |
Synonyms: | 3-(1'-(2,4-dichlorobenzyl)-2'-oxospiro[[1,3]dioxolane-2,3'-indoline]-7'-yl)-N-(4,5-dichlorothiophen-2-ylsulfonyl)acrylamide | CHEMBL1089115 |
Type | Small organic molecule |
Emp. Form. | C24H16Cl4N2O6S2 |
Mol. Mass. | 634.336 |
SMILES | Clc1cc(sc1Cl)S(=O)(=O)NC(=O)\C=C\c1cccc2c1N(Cc1ccc(Cl)cc1Cl)C(=O)C21OCCO1 |
Structure |
|