Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50109383 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_624738 (CHEMBL1113414) |
---|
Ki | 83±n/a nM |
---|
Citation | Stavitskaya, L; Seminerio, MJ; Matthews-Tsourounis, MM; Matsumoto, RR; Coop, A The effect of the pyridyl nitrogen position in pyridylpiperazine sigma ligands. Bioorg Med Chem Lett20:2564-5 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50109383 |
---|
n/a |
---|
Name | BDBM50109383 |
Synonyms: | 1-(3-Phenyl-propyl)-4-pyridin-2-yl-piperazine | 1-(3-phenylpropyl)-4-(pyridin-2-yl)piperazine | CHEMBL145867 |
Type | Small organic molecule |
Emp. Form. | C18H23N3 |
Mol. Mass. | 281.3953 |
SMILES | C(CN1CCN(CC1)c1ccccn1)Cc1ccccc1 |
Structure |
|