| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50349862 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_760694 (CHEMBL1815679) |
|---|
| Ki | 417±n/a nM |
|---|
| Citation |  Vangveravong, S; Zhang, Z; Taylor, M; Bearden, M; Xu, J; Cui, J; Wang, W; Luedtke, RR; Mach, RH Synthesis and characterization of selective dopamine D2 receptor ligands using aripiprazole as the lead compound. Bioorg Med Chem19:3502-11 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50349862 |
|---|
| n/a |
|---|
| Name | BDBM50349862 |
|---|
| Synonyms: | CHEMBL1813586 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H29ClN2O3 |
|---|
| Mol. Mass. | 428.952 |
|---|
| SMILES | OC1(CCN(CCCCOc2ccc3CCC(=O)Nc3c2)CC1)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
