Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50361661 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_799744 (CHEMBL1941450) |
---|
Ki | 437±n/a nM |
---|
Citation | Gitto, R; De Luca, L; Ferro, S; Buemi, MR; Russo, E; De Sarro, G; Costa, L; Ciranna, L; Prezzavento, O; Arena, E; Ronsisvalle, S; Bruno, G; Chimirri, A Synthesis and biological characterization of 3-substituted-1H-indoles as ligands of GluN2B-containing N-methyl-D-aspartate receptors. J Med Chem54:8702-6 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50361661 |
---|
n/a |
---|
Name | BDBM50361661 |
Synonyms: | CHEMBL1940484 |
Type | Small organic molecule |
Emp. Form. | C21H23N3O2 |
Mol. Mass. | 349.4262 |
SMILES | Oc1ccc2[nH]cc(C(=O)CN3CCN(Cc4ccccc4)CC3)c2c1 |
Structure |
|