Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cytidine deaminase |
---|
Ligand | BDBM50421666 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_52531 |
---|
Ki | 400±n/a nM |
---|
Citation | Kim, CH; Marquez, VE; Mao, DT; Haines, DR; McCormack, JJ Synthesis of pyrimidin-2-one nucleosides as acid-stable inhibitors of cytidine deaminase. J Med Chem29:1374-80 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytidine deaminase |
---|
Name: | Cytidine deaminase |
Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
Type: | PROTEIN |
Mol. Mass.: | 16129.75 |
Organism: | Mus musculus |
Description: | ChEMBL_52531 |
Residue: | 146 |
Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
BDBM50421666 |
---|
n/a |
---|
Name | BDBM50421666 |
Synonyms: | CHEMBL2311128 | US9040501, 876404 |
Type | Small organic molecule |
Emp. Form. | C9H16N2O6 |
Mol. Mass. | 248.2331 |
SMILES | OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)N1CCC(O)NC1=O |
Structure |
|