| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50368642 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159976 |
|---|
| Ki | 20±n/a nM |
|---|
| Citation |  Caflisch, A; Miranker, A; Karplus, M Multiple copy simultaneous search and construction of ligands in binding sites: application to inhibitors of HIV-1 aspartic proteinase. J Med Chem36:2142-67 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50368642 |
|---|
| n/a |
|---|
| Name | BDBM50368642 |
|---|
| Synonyms: | ACETYLPEPSTATIN |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H57N5O9 |
|---|
| Mol. Mass. | 643.8124 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(C)=O)C(C)C)C(C)C)[C@@H](O)CC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
