Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50040288 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201716 (CHEMBL803753) |
---|
IC50 | 1549±n/a nM |
---|
Citation | Wyrick, SD; Booth, RG; Myers, AM; Owens, CE; Kula, NS; Baldessarini, RJ; McPhail, AT; Mailman, RB Synthesis and pharmacological evaluation of 1-phenyl-3-amino-1,2,3,4-tetrahydronaphthalenes as ligands for a novel receptor with sigma-like neuromodulatory activity. J Med Chem36:2542-51 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50040288 |
---|
n/a |
---|
Name | BDBM50040288 |
Synonyms: | CHEMBL540038 | trans-Allyl-methyl-(4-phenyl-1,2,3,4-tetrahydro-naphthalen-2-yl)-amine; hydrochloride |
Type | Small organic molecule |
Emp. Form. | C20H23N |
Mol. Mass. | 277.4033 |
SMILES | CN(CC=C)C1CC(c2ccccc2)c2ccccc2C1 |
Structure |
|