| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50037974 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212378 (CHEMBL878759) |
|---|
| Ki | 31000±n/a nM |
|---|
| Citation |  Hilpert, K; Ackermann, J; Banner, DW; Gast, A; Gubernator, K; Hadváry, P; Labler, L; Müller, K; Schmid, G; Tschopp, TB Design and synthesis of potent and highly selective thrombin inhibitors. J Med Chem37:3889-901 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM50037974 |
|---|
| n/a |
|---|
| Name | BDBM50037974 |
|---|
| Synonyms: | (R)-N-((S)-1-Carbamimidoyl-piperidin-3-ylmethyl)-2-(naphthalene-2-sulfonylamino)-3-(4-nitro-phenyl)-propionamide; hydrochloride | CHEMBL555314 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N6O5S |
|---|
| Mol. Mass. | 538.619 |
|---|
| SMILES | N\C([NH-])=[N+]1/CCCC(CNC(=O)C(Cc2ccc(cc2)[N+]([O-])=O)NS(=O)(=O)c2ccc3ccccc3c2)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
