| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50371354 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_463233 (CHEMBL930623) |
|---|
| IC50 | 1±n/a nM |
|---|
| Citation |  Ott, GR; Asakawa, N; Lu, Z; Liu, RQ; Covington, MB; Vaddi, K; Qian, M; Newton, RC; Christ, DD; Traskos, JM; Decicco, CP; Duan, JJ Alpha,beta-cyclic-beta-benzamido hydroxamic acids: novel templates for the design, synthesis, and evaluation of selective inhibitors of TNF-alpha converting enzyme (TACE). Bioorg Med Chem Lett18:694-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50371354 |
|---|
| n/a |
|---|
| Name | BDBM50371354 |
|---|
| Synonyms: | CHEMBL256805 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26N4O6 |
|---|
| Mol. Mass. | 478.4971 |
|---|
| SMILES | COC(=O)N1C[C@@H](NC(=O)c2ccc(OCc3cc(C)nc4ccccc34)cc2)[C@H](C1)C(=O)NO |
|---|
| Structure | 
|
|---|
Search and Browse
