Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50252835 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_534601 (CHEMBL989026) |
---|
Ki | 18±n/a nM |
---|
Citation | Le Bourdonnec, B; Windh, RT; Ajello, CW; Leister, LK; Gu, M; Chu, GH; Tuthill, PA; Barker, WM; Koblish, M; Wiant, DD; Graczyk, TM; Belanger, S; Cassel, JA; Feschenko, MS; Brogdon, BL; Smith, SA; Christ, DD; Derelanko, MJ; Kutz, S; Little, PJ; DeHaven, RN; DeHaven-Hudkins, DL; Dolle, RE Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-piperidine]-4-yl)benzamide (ADL5859). J Med Chem51:5893-6 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50252835 |
---|
n/a |
---|
Name | BDBM50252835 |
Synonyms: | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzonitrile | CHEMBL495278 |
Type | Small organic molecule |
Emp. Form. | C20H18N2O |
Mol. Mass. | 302.3697 |
SMILES | N#Cc1ccc(cc1)C1=CC2(CCNCC2)Oc2ccccc12 |t:9| |
Structure |
|