Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM22032 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_719143 (CHEMBL1679493) |
---|
IC50 | 490±n/a nM |
---|
Citation | Chen, Y; Sajjad, M; Wang, Y; Batt, C; Nabi, HA; Pandey, RK TSPO 18 kDa (PBR) Targeted Photosensitizers for Cancer Imaging (PET) and PDT. ACS Med Chem Lett2:136-141 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM22032 |
---|
n/a |
---|
Name | BDBM22032 |
Synonyms: | 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195 |
Type | radiolabeled ligand |
Emp. Form. | C21H21ClN2O |
Mol. Mass. | 352.857 |
SMILES | CCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
Structure |
|