Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50389025 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_833107 (CHEMBL2067311) |
---|
Ki | 0.31±n/a nM |
---|
Citation | Oberdorf, C; Schepmann, D; Vela, JM; Buschmann, H; Holenz, J; Wünsch, B Thiophene bioisosteres of spirocyclics receptor ligands: relationships between substitution pattern ands receptor affinity. J Med Chem55:5350-60 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50389025 |
---|
n/a |
---|
Name | BDBM50389025 |
Synonyms: | CHEMBL2064198 |
Type | Small organic molecule |
Emp. Form. | C18H21NOS |
Mol. Mass. | 299.43 |
SMILES | C(N1CCC2(CC1)OCCc1sccc21)c1ccccc1 |
Structure |
|