Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50338990 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_834663 (CHEMBL2072549) |
---|
Ki | 4.6±n/a nM |
---|
Citation | Moussa, IA; Banister, SD; Manoli, M; Doddareddy, MR; Cui, J; Mach, RH; Kassiou, M Exploration of ring size in a series of cyclic vicinal diamines withs1 receptor affinity. Bioorg Med Chem Lett22:5493-7 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50338990 |
---|
n/a |
---|
Name | BDBM50338990 |
Synonyms: | 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine | CHEMBL2311153 | CHEMBL408867 | N-phenylpropyl-N''-3,4-dimethoxyphenethyl piperazine |
Type | Small organic molecule |
Emp. Form. | C23H32N2O2 |
Mol. Mass. | 368.5124 |
SMILES | COc1ccc(CCN2CCN(CCCc3ccccc3)CC2)cc1OC |
Structure |
|