Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM50402649 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_886799 (CHEMBL2210490) |
---|
IC50 | 12000±n/a nM |
---|
Citation | Sarkis, M; Tran, DN; Kolb, S; Miteva, MA; Villoutreix, BO; Garbay, C; Braud, E Design and synthesis of novel bis-thiazolone derivatives as micromolar CDC25 phosphatase inhibitors: effect of dimerisation on phosphatase inhibition. Bioorg Med Chem Lett22:7345-50 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM50402649 |
---|
n/a |
---|
Name | BDBM50402649 |
Synonyms: | CHEMBL2206736 |
Type | Small organic molecule |
Emp. Form. | C33H32N4O6S2 |
Mol. Mass. | 644.76 |
SMILES | OC(=O)C=Cc1ccc(C=C2SC(NCCCCCCCNC3=NC(=O)C(S3)=Cc3ccc(C=CC(O)=O)cc3)=NC2=O)cc1 |w:4.4,34.35,28.29,9.8,c:41,t:22| |
Structure |
|