Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50421662 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54243 (CHEMBL668120) |
---|
IC50 | 3000±n/a nM |
---|
Citation | Roth, B; Aig, E; Lane, K; Rauckman, BS 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 4. 6-Substituted trimethoprim derivatives from phenolic Mannich intermediates. Application to the synthesis of trimethoprim and 3,5-dialkylbenzyl analogues. J Med Chem23:535-41 (1980) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50421662 |
---|
n/a |
---|
Name | BDBM50421662 |
Synonyms: | CHEMBL358879 |
Type | Small organic molecule |
Emp. Form. | C20H22N4O3 |
Mol. Mass. | 366.4137 |
SMILES | COc1cc(Cc2c(N)nc(N)nc2-c2ccccc2)cc(OC)c1OC |
Structure |
|