| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50434295 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_961969 (CHEMBL2390710) |
|---|
| EC50 | 324±n/a nM |
|---|
| Citation |  Christiansen, E; Hansen, SV; Urban, C; Hudson, BD; Wargent, ET; Grundmann, M; Jenkins, L; Zaibi, M; Stocker, CJ; Ullrich, S; Kostenis, E; Kassack, MU; Milligan, G; Cawthorne, MA; Ulven, T Discovery of TUG-770: A Highly Potent Free Fatty Acid Receptor 1 (FFA1/GPR40) Agonist for Treatment of Type 2 Diabetes. ACS Med Chem Lett4:441-445 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31848.38 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1511162 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
|---|
| BDBM50434295 |
|---|
| n/a |
|---|
| Name | BDBM50434295 |
|---|
| Synonyms: | CHEMBL2386353 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14FNO2 |
|---|
| Mol. Mass. | 307.3184 |
|---|
| SMILES | OC(=O)CCc1ccc(cc1F)C#Cc1ccccc1CC#N |
|---|
| Structure | 
|
|---|
Search and Browse
