Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50434295 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_961970 (CHEMBL2390711) |
---|
EC50 | 148±n/a nM |
---|
Citation | Christiansen, E; Hansen, SV; Urban, C; Hudson, BD; Wargent, ET; Grundmann, M; Jenkins, L; Zaibi, M; Stocker, CJ; Ullrich, S; Kostenis, E; Kassack, MU; Milligan, G; Cawthorne, MA; Ulven, T Discovery of TUG-770: A Highly Potent Free Fatty Acid Receptor 1 (FFA1/GPR40) Agonist for Treatment of Type 2 Diabetes. ACS Med Chem Lett4:441-445 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31818.80 |
Organism: | Mus musculus |
Description: | ChEMBL_1454431 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
BDBM50434295 |
---|
n/a |
---|
Name | BDBM50434295 |
Synonyms: | CHEMBL2386353 |
Type | Small organic molecule |
Emp. Form. | C19H14FNO2 |
Mol. Mass. | 307.3184 |
SMILES | OC(=O)CCc1ccc(cc1F)C#Cc1ccccc1CC#N |
Structure |
|