Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
---|
Ligand | BDBM50019859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1361547 (CHEMBL3294871) |
---|
Kd | 16±n/a nM |
---|
Citation | Zimmermann, G; Schultz-Fademrecht, C; Küchler, P; Murarka, S; Ismail, S; Triola, G; Nussbaumer, P; Wittinghofer, A; Waldmann, H Structure guided design and kinetic analysis of highly potent benzimidazole inhibitors targeting the PDEd prenyl binding site. J Med Chem57:5435-48 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
---|
Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
Type: | PROTEIN |
Mol. Mass.: | 17418.30 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_105761 |
Residue: | 150 |
Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
BDBM50019859 |
---|
n/a |
---|
Name | BDBM50019859 |
Synonyms: | CHEMBL3286923 |
Type | Small organic molecule |
Emp. Form. | C37H42FN3O5 |
Mol. Mass. | 627.7449 |
SMILES | CC(C)c1c(C(=O)Nc2ccccc2)c(c(-c2ccc(F)cc2)n1CC[C@@H](O)C[C@@H](O)CC(=O)N1CCOCC1)-c1ccccc1 |r| |
Structure |
|