| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM22496 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1433672 (CHEMBL3385788) |
|---|
| EC50 | 316±n/a nM |
|---|
| Citation |  Helal, MA; Darwish, KM; Hammad, MA Homology modeling and explicit membrane molecular dynamics simulation to delineate the mode of binding of thiazolidinediones into FFAR1 and the mechanism of receptor activation. Bioorg Med Chem Lett24:5330-6 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM22496 |
|---|
| n/a |
|---|
| Name | BDBM22496 |
|---|
| Synonyms: | 3-(4-{[(3-phenoxyphenyl)methyl]amino}phenyl)propanoic acid | CHEMBL207881 | carboxylic acid agonist, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H21NO3 |
|---|
| Mol. Mass. | 347.407 |
|---|
| SMILES | OC(=O)CCc1ccc(NCc2cccc(Oc3ccccc3)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
