| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50179401 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1583800 |
|---|
| IC50 | 50750±n/a nM |
|---|
| Citation |  Khan, FA; Patil, RH; Shinde, DB; Sangshetti, JN Bacterial Peptide deformylase inhibition of cyano substituted biaryl analogs: Synthesis, in vitro biological evaluation, molecular docking study and in silico ADME prediction. Bioorg Med Chem24:3456-63 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 16901.39 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
|---|
| BDBM50179401 |
|---|
| n/a |
|---|
| Name | BDBM50179401 |
|---|
| Synonyms: | CHEMBL3814164 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13N5 |
|---|
| Mol. Mass. | 275.3079 |
|---|
| SMILES | N#Cc1ccccc1-c1ccc(CNn2cnnc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
