| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50406002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53943 (CHEMBL668662) |
|---|
| Ki | 6918±n/a nM |
|---|
| Citation |  Li, RL; Dietrich, SW; Hansch, C Quantitative structure-selectivity relationships. Comparison of the inhibition of Escherichia coli and bovine liver dihydrofolate reductase by 5-(substituted-benzyl)-2,4-diaminopyrimidines. J Med Chem24:538-44 (1981) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM50406002 |
|---|
| n/a |
|---|
| Name | BDBM50406002 |
|---|
| Synonyms: | CHEMBL18912 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14N6O3 |
|---|
| Mol. Mass. | 302.2887 |
|---|
| SMILES | CC(=O)Nc1ccc(Cc2cnc(N)nc2N)cc1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
