Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50081917 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_53943 (CHEMBL668662) |
---|
Ki | 407±n/a nM |
---|
Citation | Li, RL; Dietrich, SW; Hansch, C Quantitative structure-selectivity relationships. Comparison of the inhibition of Escherichia coli and bovine liver dihydrofolate reductase by 5-(substituted-benzyl)-2,4-diaminopyrimidines. J Med Chem24:538-44 (1981) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM50081917 |
---|
n/a |
---|
Name | BDBM50081917 |
Synonyms: | 5-(3-Hexyloxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL31547 |
Type | Small organic molecule |
Emp. Form. | C17H24N4O |
Mol. Mass. | 300.3987 |
SMILES | CCCCCCOc1cccc(Cc2cnc(N)nc2N)c1 |
Structure |
|