Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50081908 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54735 (CHEMBL667186) |
---|
Ki | 117±n/a nM |
---|
Citation | Doweyko, AM The hypothetical active site lattice. An approach to modelling active sites from data on inhibitor molecules. J Med Chem31:1396-406 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50081908 |
---|
n/a |
---|
Name | BDBM50081908 |
Synonyms: | 5-(3-Methoxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL18967 |
Type | Small organic molecule |
Emp. Form. | C12H14N4O |
Mol. Mass. | 230.2658 |
SMILES | COc1cccc(Cc2cnc(N)nc2N)c1 |
Structure |
|