Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Pro-neuropeptide Y |
---|
Ligand | BDBM82300 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.4±n/a nM |
---|
Comments | PDSP_1512 |
---|
Citation | Yan, H; Yang, J; Marasco, J; Yamaguchi, K; Brenner, S; Collins, F; Karbon, W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A93:4661-5 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pro-neuropeptide Y |
---|
Name: | Pro-neuropeptide Y |
Synonyms: | NPY_RAT | Neuropeptide Y | Npy | Pro-neuropeptide Y |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11033.13 |
Organism: | RAT |
Description: | Neuropeptide Y 0 RAT::P07808 |
Residue: | 98 |
Sequence: | MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
|
|
|
BDBM82300 |
---|
n/a |
---|
Name | BDBM82300 |
Synonyms: | CAS_59763-91-6 | NSC_41735 | PP, rat |
Type | Small organic molecule |
Emp. Form. | C195H302N58O57S |
Mol. Mass. | 4402.902 |
SMILES | n/a |
Structure |
|