Reaction Details |
| Report a problem with these data |
Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Ligand | BDBM280035 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Assays for IDH1m (R132H or R132C) Inhibitors |
---|
pH | 6.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | <50±n/a nM |
---|
Comments | extracted |
---|
Citation | Konteatis, ZD; Popovici-Muller, J; Travins, JM; Zahler, R; Cai, Z; Zhou, D Therapeutically active compounds and their methods of use US Patent US10028961 Publication Date 7/24/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
Type: | Protein |
Mol. Mass.: | 46641.74 |
Organism: | Homo sapiens (Human) |
Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
Residue: | 414 |
Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
BDBM280035 |
---|
n/a |
---|
Name | BDBM280035 |
Synonyms: | US10028961, Compound 188 | US10172864, Compound 188 | US10946023, Compound 188 |
Type | Small organic molecule |
Emp. Form. | C22H20F5N7 |
Mol. Mass. | 477.4331 |
SMILES | FC(F)(F)c1cccc(n1)-c1nc(NC2CCC(F)(F)C2)nc(NC2Cc3cccnc3C2)n1 |
Structure |
|