| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-7 |
|---|
| Ligand | BDBM100017 |
|---|
| Substrate/Competitor | n/a |
|---|
| EC50 | >69513±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence Intensity-based biochemical primary high throughput dose response assay to identify activators of kallikrein-7 (K7) zymogen PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Kallikrein-7 |
|---|
| Name: | Kallikrein-7 |
|---|
| Synonyms: | KLK7 | KLK7_HUMAN | Kallikrein 7 | Kallikrein-7 | PRSS6 | SCCE | Serine protease 6 | Stratum corneum chymotryptic enzyme | hK7 | hSCCE | kallikrein-7 isoform 1 preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27535.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469257 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR
|
|
|
|---|
| BDBM100017 |
|---|
| n/a |
|---|
| Name | BDBM100017 |
|---|
| Synonyms: | 3-O-ethyl 8-O-methyl 4-(furan-2-ylmethylamino)quinoline-3,8-dicarboxylate | 3-ethyl 8-methyl 4-[(2-furylmethyl)amino]-3,8-quinolinedicarboxylate | 4-(2-furanylmethylamino)quinoline-3,8-dicarboxylic acid O3-ethyl ester O8-methyl ester | 4-(2-furfurylamino)quinoline-3,8-dicarboxylic acid O3-ethyl ester O8-methyl ester | MLS000063391 | O3-ethyl O8-methyl 4-(furan-2-ylmethylamino)quinoline-3,8-dicarboxylate | SMR000072645 | cid_1078123 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18N2O5 |
|---|
| Mol. Mass. | 354.3566 |
|---|
| SMILES | CCOC(=O)c1cnc2c(cccc2c1NCc1ccco1)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
