| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Ligand | BDBM114202 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Epi Absorbance-based biochemical high throughput dose response assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2) |
|---|
| IC50 | 4777±n/a nM |
|---|
| Citation |  PubChem, PC Epi Absorbance-based biochemical high throughput dose response assay to identify inhibitors of human tyrosyl-DNA phosphodiesterase 2 (TDP2) PubChem Bioassay(2014)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Name: | Tyrosyl-DNA phosphodiesterase 2 |
|---|
| Synonyms: | EAP2 | EAPII | ETS1-associated protein 2 | ETS1-associated protein II | TDP2 | TRAF and TNF receptor-associated protein | TTRAP | TYDP2_HUMAN | Tyr-DNA phosphodiesterase 2 | Tyrosyl-DNA phosphodiesterase 2 | Tyrosyl-DNA phosphodiesterase 2 (hTDP2) | Tyrosyl-RNA phosphodiesterase | VPg unlinkase | hTDP2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40916.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_23510348 |
|---|
| Residue: | 362 |
|---|
| Sequence: | MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNS
YFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWN
IDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFT
AIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQ
LKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ
MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDI
IL
|
|
|
|---|
| BDBM114202 |
|---|
| n/a |
|---|
| Name | BDBM114202 |
|---|
| Synonyms: | 2-methyl-4,5-dioxo-3-(phenylmethyl)-1-benzo[e]indolecarboxylic acid ethyl ester | 3-benzyl-4,5-diketo-2-methyl-benz[e]indole-1-carboxylic acid ethyl ester | MLS002702495 | SMR001566056 | cid_406008 | ethyl 2-methyl-4,5-bis(oxidanylidene)-3-(phenylmethyl)benzo[e]indole-1-carboxylate | ethyl 3-benzyl-2-methyl-4,5-dioxobenzo[e]indole-1-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H19NO4 |
|---|
| Mol. Mass. | 373.4013 |
|---|
| SMILES | CCOC(=O)c1c(C)n(Cc2ccccc2)c2c1-c1ccccc1C(=O)C2=O |
|---|
| Structure | 
|
|---|
Search and Browse
